Lineage for d1yo6f1 (1yo6 F:2-250)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820564Protein Putative carbonyl reductase sniffer [141913] (1 species)
  7. 820565Species Caenorhabditis elegans [TaxId:6239] [141914] (1 PDB entry)
    Uniprot P90780 1-250
  8. 820571Domain d1yo6f1: 1yo6 F:2-250 [123774]
    automatically matched to 1YO6 A:1-250

Details for d1yo6f1

PDB Entry: 1yo6 (more details), 2.6 Å

PDB Description: Crystal Structure of the putative Carbonyl Reductase Sniffer of Caenorhabditis elegans
PDB Compounds: (F:) Putative Carbonyl Reductase Sniffer

SCOP Domain Sequences for d1yo6f1:

Sequence, based on SEQRES records: (download)

>d1yo6f1 c.2.1.2 (F:2-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]}
spgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksikdsrvhvlpltvt
cdksldtfvskvgeivgsdglsllinnagvllsygtntepnraviaeqldvnttsvvllt
qkllpllknaaskesgdqlsvsraavitissglgsitdntsgsaqfpvlayrmskaainm
fgrtlavdlkddnvlvvnfcpgwvqtnlggknaaltveqstaelissfnkldnshngrff
mrnlkpyef

Sequence, based on observed residues (ATOM records): (download)

>d1yo6f1 c.2.1.2 (F:2-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]}
spgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksdsrvhvlpltvtcd
ksldtfvskvgeivgsdsllinnagvllsygtntepnraviaeqldvnttsvvlltqkll
pllknaaskedqlsvsraavitissglgsitdntsgsaqfpvlayrmskaainmfgrtla
vdlkddnvlvvnfcpgwveqstaelissfnkldnshngrffmrnlkpyef

SCOP Domain Coordinates for d1yo6f1:

Click to download the PDB-style file with coordinates for d1yo6f1.
(The format of our PDB-style files is described here.)

Timeline for d1yo6f1: