Lineage for d1yo6c1 (1yo6 C:1-250)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 686289Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 687031Protein Putative carbonyl reductase sniffer [141913] (1 species)
  7. 687032Species Caenorhabditis elegans [TaxId:6239] [141914] (1 PDB entry)
  8. 687035Domain d1yo6c1: 1yo6 C:1-250 [123771]
    automatically matched to 1YO6 A:1-250

Details for d1yo6c1

PDB Entry: 1yo6 (more details), 2.6 Å

PDB Description: Crystal Structure of the putative Carbonyl Reductase Sniffer of Caenorhabditis elegans
PDB Compounds: (C:) Putative Carbonyl Reductase Sniffer

SCOP Domain Sequences for d1yo6c1:

Sequence, based on SEQRES records: (download)

>d1yo6c1 c.2.1.2 (C:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]}
mspgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksikdsrvhvlpltv
tcdksldtfvskvgeivgsdglsllinnagvllsygtntepnraviaeqldvnttsvvll
tqkllpllknaaskesgdqlsvsraavitissglgsitdntsgsaqfpvlayrmskaain
mfgrtlavdlkddnvlvvnfcpgwvqtnlggknaaltveqstaelissfnkldnshngrf
fmrnlkpyef

Sequence, based on observed residues (ATOM records): (download)

>d1yo6c1 c.2.1.2 (C:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]}
mspgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksikdsrvhvlpltv
tcdksldtfvskvgeivgsdglsllinnagvllsygtntepnraviaeqldvnttsvvll
tqkllpllknaaskesgdqlsvsraavitissglgsitdntsgsaqfpvlayrmskaain
mfgrtlavdlkddnvlvvnfcpgwvqtveqstaelissfnkldnshngrffmrnlkpyef

SCOP Domain Coordinates for d1yo6c1:

Click to download the PDB-style file with coordinates for d1yo6c1.
(The format of our PDB-style files is described here.)

Timeline for d1yo6c1: