Lineage for d1yo5c1 (1yo5 C:247-334)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693426Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 2693458Protein Sam pointed domain containing ets transcription SPDEF [140267] (1 species)
  7. 2693459Species Human (Homo sapiens) [TaxId:9606] [140268] (1 PDB entry)
    Uniprot O95238 247-334
  8. 2693460Domain d1yo5c1: 1yo5 C:247-334 [123768]
    protein/DNA complex

Details for d1yo5c1

PDB Entry: 1yo5 (more details), 2 Å

PDB Description: Analysis of the 2.0A crystal structure of the protein-DNA complex of human PDEF Ets domain bound to the prostate specific antigen regulatory site
PDB Compounds: (C:) SAM pointed domain containing ets transcription factor

SCOPe Domain Sequences for d1yo5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yo5c1 a.4.5.21 (C:247-334) Sam pointed domain containing ets transcription SPDEF {Human (Homo sapiens) [TaxId: 9606]}
qpihlwqflkelllkphsygrfirwlnkekgifkiedsaqvarlwgirknrpamnydkls
rsirqyykkgiirkpdisqrlvyqfvhp

SCOPe Domain Coordinates for d1yo5c1:

Click to download the PDB-style file with coordinates for d1yo5c1.
(The format of our PDB-style files is described here.)

Timeline for d1yo5c1: