Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.6: Hydantoinase (dihydropyrimidinase), catalytic domain [75073] (5 proteins) |
Protein D-hydantoinase [75074] (4 species) |
Species Bacillus sp. AR9 [TaxId:301298] [141802] (1 PDB entry) Uniprot Q5DLU2 2-460 |
Domain d1ynyb2: 1yny B:53-384 [123767] Other proteins in same PDB: d1ynya1, d1ynyb1 automatically matched to 1YNY A:53-384 complexed with mn |
PDB Entry: 1yny (more details), 2.3 Å
SCOPe Domain Sequences for d1ynyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ynyb2 c.1.9.6 (B:53-384) D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} ggidphthldmpfggtvtaddfftgtraaafggttsivdfcltkkgeslksaiatwheka rgkavidygfhlmiaeandqvleelesvissegitslkvfmayknvfqaddetlfktlvk akelgalvqvhaengdvldyltkkalaegntdpiyhaytrppeaegeatgraialtalag sqlyvvhvscasavqriaearekgwnvygetcpqylaldvsimdqpdfegakyvwspplr ekwnqevlwsalkngilqtvgsdhcpfnfrgqkelgrgdftkipnggpliedrltilyse gvrqgrislnqfvdisstkaaklfgmfprkgt
Timeline for d1ynyb2: