SCOPe 2.06: Domain d1ynwb_: 1ynw B:

Lineage for d1ynwb_ (1ynw B:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
   duplication: two zinc-binding motifs

6. Protein automated matches [190314] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188623] (3 PDB entries)

8. Domain d1ynwb_: 1ynw B: [123763]
   Other proteins in same PDB: d1ynwa1
   automated match to d1r0nb_
   protein/DNA complex; complexed with zn

Details for d1ynwb_

PDB Entry: 1ynw, 3 Å

PDB Description: crystal structure of vitamin d receptor and 9-cis retinoic acid receptor dna-binding domains bound to a dr3 response element

PDB Compounds: (B:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1ynwb_:

Sequence; same for both SEQRES and ATOM records:

>d1ynwb_ g.39.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
icaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqycryq
kclamgmkreavq

Timeline for d1ynwb_:

• d1ynwb_ first appeared in SCOP 1.73, called d1ynwb1
  
• d1ynwb_ appears in SCOPe 2.05
  
• d1ynwb_ appears in SCOPe 2.07
  
• d1ynwb_ appears in the current release, SCOPe 2.08