Lineage for d1ynua_ (1ynu A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131691Protein 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) [53440] (2 species)
  7. 2131692Species Apple (Malus domestica) [TaxId:3750] [53441] (5 PDB entries)
  8. 2131696Domain d1ynua_: 1ynu A: [123762]
    automated match to d1m7ya_
    complexed with k, ni, py4, trs

Details for d1ynua_

PDB Entry: 1ynu (more details), 2.25 Å

PDB Description: Crystal structure of apple ACC synthase in complex with L-vinylglycine
PDB Compounds: (A:) 1-aminocyclopropane-1-carboxylate synthase

SCOPe Domain Sequences for d1ynua_:

Sequence, based on SEQRES records: (download)

>d1ynua_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]}
lsrnatfnshgqdssyflgwqeyeknpyhevhntngiiqmglaenqlcfdlleswlaknp
eaaafkkngesifaelalfqdyhglpafkkamvdfmaeirgnkvtfdpnhlvltagatsa
netfifcladpgeavliptpyypgfdrdlkwrtgveivpihctssngfqitetaleeayq
eaekrnlrvkgvlvtnpsnplgttmtrnelylllsfvedkgihlisdeiysgtafsspsf
isvmevlkdrncdensevwqrvhvvyslskdlglpgfrvgaiysnddmvvaaatkmssfg
lvssqtqhllsamlsdkkltknyiaenhkrlkqrqkklvsglqksgisclngnaglfcwv
dmrhllrsntfeaemelwkkivyevhlnispgsschctepgwfrvcfanlpertldlamq
rlkafvgeyy

Sequence, based on observed residues (ATOM records): (download)

>d1ynua_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]}
lsrnatssyflgwqeyeknpyhevhntngiiqmglaenqlcfdlleswlaknpeaaafkk
ngesifaelalfqdyhglpafkkamvdfmaeirgnkvtfdpnhlvltagatsanetfifc
ladpgeavliptpyypgfdrdlkwrtgveivpihctssngfqitetaleeayqeaekrnl
rvkgvlvtnpsnplgttmtrnelylllsfvedkgihlisdeiysgtafsspsfisvmevl
kdsevwqrvhvvyslskdlglpgfrvgaiysnddmvvaaatkmssfglvssqtqhllsam
lsdkkltknyiaenhkrlkqrqkklvsglqksgisclngnaglfcwvdmrhllrsntfea
emelwkkivyevhlnispgsschctepgwfrvcfanlpertldlamqrlkafvgeyy

SCOPe Domain Coordinates for d1ynua_:

Click to download the PDB-style file with coordinates for d1ynua_.
(The format of our PDB-style files is described here.)

Timeline for d1ynua_: