Lineage for d1yntg2 (1ynt G:3132-3254)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2772780Superfamily b.6.2: Major surface antigen p30, SAG1 [74877] (1 family) (S)
    SS-crosslinked beta-sandwich of distinct geometry but topologically similar to cupredoxins
    automatically mapped to Pfam PF04092
  5. 2772781Family b.6.2.1: Major surface antigen p30, SAG1 [74878] (2 proteins)
  6. Protein automated matches [254459] (1 species)
    not a true protein
  7. Species Toxoplasma gondii [TaxId:5811] [254985] (1 PDB entry)
  8. 2772793Domain d1yntg2: 1ynt G:3132-3254 [123761]
    Other proteins in same PDB: d1ynta1, d1ynta2, d1yntb1, d1yntb2, d1yntc1, d1yntc2, d1yntd1, d1yntd2, d1ynte_
    automated match to d1kzqa2
    complexed with cd

Details for d1yntg2

PDB Entry: 1ynt (more details), 3.1 Å

PDB Description: structure of the monomeric form of t. gondii sag1 surface antigen bound to a human fab
PDB Compounds: (G:) Major Surface Antigen P30

SCOPe Domain Sequences for d1yntg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yntg2 b.6.2.1 (G:3132-3254) automated matches {Toxoplasma gondii [TaxId: 5811]}
assvvnnvarcsygadstlgpvklsaegpttmtlvcgkdgvkvpqdnnqycsgttltgcn
eksfkdilpkltenpwqgnassdkgatltikkeafpaesksviigctggspekhhctvkl
efa

SCOPe Domain Coordinates for d1yntg2:

Click to download the PDB-style file with coordinates for d1yntg2.
(The format of our PDB-style files is described here.)

Timeline for d1yntg2: