SCOPe 2.08: Domain d1yntf2: 1ynt F:2132-2254

Lineage for d1yntf2 (1ynt F:2132-2254)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.2: Major surface antigen p30, SAG1 [74877] (1 family)
   SS-crosslinked beta-sandwich of distinct geometry but topologically similar to cupredoxins
   automatically mapped to Pfam PF04092

5. Family b.6.2.1: Major surface antigen p30, SAG1 [74878] (2 proteins)

6. Protein automated matches [254459] (1 species)
   not a true protein
7. Species Toxoplasma gondii [TaxId:5811] [254985] (1 PDB entry)

8. Domain d1yntf2: 1ynt F:2132-2254 [123759]
   Other proteins in same PDB: d1ynta1, d1ynta2, d1yntb1, d1yntb2, d1yntc1, d1yntc2, d1yntd1, d1yntd2, d1ynte_
   automated match to d1kzqa2
   complexed with cd

Details for d1yntf2

PDB Entry: 1ynt, 3.1 Å

PDB Description: structure of the monomeric form of t. gondii sag1 surface antigen bound to a human fab

PDB Compounds: (F:) Major Surface Antigen P30

SCOPe Domain Sequences for d1yntf2:

Sequence; same for both SEQRES and ATOM records:

>d1yntf2 b.6.2.1 (F:2132-2254) automated matches {Toxoplasma gondii [TaxId: 5811]}
assvvnnvarcsygadstlgpvklsaegpttmtlvcgkdgvkvpqdnnqycsgttltgcn
eksfkdilpkltenpwqgnassdkgatltikkeafpaesksviigctggspekhhctvkl
efa

Timeline for d1yntf2:

• d1yntf2 first appeared in SCOP 1.73
  
• d1yntf2 appears in SCOPe 2.07