Lineage for d1ynte_ (1ynt E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934644Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)
  7. 2934645Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries)
  8. 2934665Domain d1ynte_: 1ynt E: [123757]
    Other proteins in same PDB: d1ynta1, d1ynta2, d1yntb1, d1yntb2, d1yntc1, d1yntc2, d1yntd1, d1yntd2, d1yntf1, d1yntf2, d1yntg1, d1yntg2
    automated match to d1heze_
    complexed with cd

Details for d1ynte_

PDB Entry: 1ynt (more details), 3.1 Å

PDB Description: structure of the monomeric form of t. gondii sag1 surface antigen bound to a human fab
PDB Compounds: (E:) protein l

SCOPe Domain Sequences for d1ynte_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynte_ d.15.7.1 (E:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]}
evtikvnlifadgkiqtaefkgtfeeataeayryadllakvngeytadledggnhmnikf
a

SCOPe Domain Coordinates for d1ynte_:

Click to download the PDB-style file with coordinates for d1ynte_.
(The format of our PDB-style files is described here.)

Timeline for d1ynte_: