Lineage for d1ynsa1 (1yns A:4-256)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 847927Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 847928Superfamily c.108.1: HAD-like [56784] (25 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 848346Family c.108.1.22: Enolase-phosphatase E1 [142186] (2 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 848347Protein E-1 enzyme [142189] (1 species)
  7. 848348Species Human(Homo sapiens) [TaxId:9606] [142190] (2 PDB entries)
    Uniprot Q9UHY7 4-256
  8. 848350Domain d1ynsa1: 1yns A:4-256 [123754]
    automatically matched to 1ZS9 A:4-256
    complexed with hpo, mg

Details for d1ynsa1

PDB Entry: 1yns (more details), 1.7 Å

PDB Description: crystal structure of human enolase-phosphatase e1 and its complex with a substrate analog
PDB Compounds: (A:) E-1 enzyme

SCOP Domain Sequences for d1ynsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynsa1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]}
lsvpaevtvilldiegtttpiafvkdilfpyieenvkeylqthweeeecqqdvsllrkqa
eedahldgavpipaasgngvddlqqmiqavvdnvcwqmsldrkttalkqlqghmwraaft
agrmkaeffadvvpavrkwreagmkvyiyssgsveaqkllfghstegdilelvdghfdtk
ighkvesesyrkiadsigcstnnilfltdvtreasaaeeadvhvavvvrpgnagltddek
tyyslitsfsely

SCOP Domain Coordinates for d1ynsa1:

Click to download the PDB-style file with coordinates for d1ynsa1.
(The format of our PDB-style files is described here.)

Timeline for d1ynsa1: