Lineage for d1ynsa_ (1yns A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920238Family c.108.1.22: Enolase-phosphatase E1 [142186] (3 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2920249Protein automated matches [190836] (1 species)
    not a true protein
  7. 2920250Species Human (Homo sapiens) [TaxId:9606] [188144] (1 PDB entry)
  8. 2920251Domain d1ynsa_: 1yns A: [123754]
    automated match to d1ynsa1
    complexed with hpo, mg

Details for d1ynsa_

PDB Entry: 1yns (more details), 1.7 Å

PDB Description: crystal structure of human enolase-phosphatase e1 and its complex with a substrate analog
PDB Compounds: (A:) E-1 enzyme

SCOPe Domain Sequences for d1ynsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynsa_ c.108.1.22 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsvpaevtvilldiegtttpiafvkdilfpyieenvkeylqthweeeecqqdvsllrkqa
eedahldgavpipaasgngvddlqqmiqavvdnvcwqmsldrkttalkqlqghmwraaft
agrmkaeffadvvpavrkwreagmkvyiyssgsveaqkllfghstegdilelvdghfdtk
ighkvesesyrkiadsigcstnnilfltdvtreasaaeeadvhvavvvrpgnagltddek
tyyslitsfselyl

SCOPe Domain Coordinates for d1ynsa_:

Click to download the PDB-style file with coordinates for d1ynsa_.
(The format of our PDB-style files is described here.)

Timeline for d1ynsa_: