![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.22: Enolase-phosphatase E1 [142186] (3 proteins) the insertion subdomain is a 4-helical bundle |
![]() | Protein automated matches [190836] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188144] (1 PDB entry) |
![]() | Domain d1ynsa_: 1yns A: [123754] automated match to d1ynsa1 complexed with hpo, mg |
PDB Entry: 1yns (more details), 1.7 Å
SCOPe Domain Sequences for d1ynsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ynsa_ c.108.1.22 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lsvpaevtvilldiegtttpiafvkdilfpyieenvkeylqthweeeecqqdvsllrkqa eedahldgavpipaasgngvddlqqmiqavvdnvcwqmsldrkttalkqlqghmwraaft agrmkaeffadvvpavrkwreagmkvyiyssgsveaqkllfghstegdilelvdghfdtk ighkvesesyrkiadsigcstnnilfltdvtreasaaeeadvhvavvvrpgnagltddek tyyslitsfselyl
Timeline for d1ynsa_: