Lineage for d1ynrb_ (1ynr B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. Protein Cytochrome c552 [46636] (6 species)
  7. Species Hydrogenobacter thermophilus [TaxId:940] [46640] (9 PDB entries)
  8. Domain d1ynrb_: 1ynr B: [123751]
    automated match to d1ayg__
    complexed with hec, mpd, so4

Details for d1ynrb_

PDB Entry: 1ynr (more details), 2 Å

PDB Description: Crystal structure of the cytochrome c-552 from Hydrogenobacter thermophilus at 2.0 resolution
PDB Compounds: (B:) Cytochrome c-552

SCOPe Domain Sequences for d1ynrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynrb_ a.3.1.1 (B:) Cytochrome c552 {Hydrogenobacter thermophilus [TaxId: 940]}
neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
pqnvtdaeakqlaqwilsi

SCOPe Domain Coordinates for d1ynrb_ are not available.

Timeline for d1ynrb_:

Domains from other chains:
(mouse over for more information)
d1ynra_, d1ynrc_, d1ynrd_