SCOPe 2.01: Domain d1ynoa3: 1yno A:342-525

Lineage for d1ynoa3 (1yno A:342-525)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology

6. Protein Benzoylformate decarboxylase [88756] (1 species)

7. Species Pseudomonas putida [TaxId:303] [88757] (9 PDB entries)
   Uniprot P20906

8. Domain d1ynoa3: 1yno A:342-525 [123749]
   Other proteins in same PDB: d1ynoa1, d1ynoa2
   automatically matched to d1mcza3
   complexed with ca, mg, tzd

Details for d1ynoa3

PDB Entry: 1yno, 1.22 Å

PDB Description: High Resolution Structure of Benzoylformate Decarboxylase from Pseudomonas Putida Complexed with Thiamine Thiazolone Diphosphate

PDB Compounds: (A:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d1ynoa3:

Sequence; same for both SEQRES and ATOM records:

>d1ynoa3 c.36.1.9 (A:342-525) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag
glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygal
rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev
stvs

Timeline for d1ynoa3:

• d1ynoa3 first appeared in SCOP 1.73
  
• d1ynoa3 appears in SCOP 1.75
  
• d1ynoa3 appears in SCOPe 2.02
  
• d1ynoa3 appears in the current release, SCOPe 2.08