SCOPe 2.06: Domain d1ynoa2: 1yno A:2-181

Lineage for d1ynoa2 (1yno A:2-181)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (20 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [254984] (35 PDB entries)

8. Domain d1ynoa2: 1yno A:2-181 [123748]
   Other proteins in same PDB: d1ynoa1
   automated match to d1ynoa2
   complexed with ca, mg, tzd

Details for d1ynoa2

PDB Entry: 1yno, 1.22 Å

PDB Description: High Resolution Structure of Benzoylformate Decarboxylase from Pseudomonas Putida Complexed with Thiamine Thiazolone Diphosphate

PDB Compounds: (A:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d1ynoa2:

Sequence; same for both SEQRES and ATOM records:

>d1ynoa2 c.36.1.0 (A:2-181) automated matches {Pseudomonas putida [TaxId: 303]}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss

Timeline for d1ynoa2:

• d1ynoa2 first appeared in SCOP 1.73
  
• d1ynoa2 appears in SCOPe 2.05
  
• d1ynoa2 appears in SCOPe 2.07
  
• d1ynoa2 appears in the current release, SCOPe 2.08