Lineage for d1ynoa2 (1yno A:2-181)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828800Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 828801Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 828802Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
  6. 828826Protein Benzoylformate decarboxylase [88731] (1 species)
  7. 828827Species Pseudomonas putida [TaxId:303] [88732] (9 PDB entries)
    Uniprot P20906
  8. 828832Domain d1ynoa2: 1yno A:2-181 [123748]
    Other proteins in same PDB: d1ynoa1, d1ynoa3
    automatically matched to d1bfd_2
    complexed with ca, mg, tzd

Details for d1ynoa2

PDB Entry: 1yno (more details), 1.22 Å

PDB Description: High Resolution Structure of Benzoylformate Decarboxylase from Pseudomonas Putida Complexed with Thiamine Thiazolone Diphosphate
PDB Compounds: (A:) Benzoylformate decarboxylase

SCOP Domain Sequences for d1ynoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynoa2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss

SCOP Domain Coordinates for d1ynoa2:

Click to download the PDB-style file with coordinates for d1ynoa2.
(The format of our PDB-style files is described here.)

Timeline for d1ynoa2: