| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
| Protein Benzoylformate decarboxylase [52482] (1 species) |
| Species Pseudomonas putida [TaxId:303] [52483] (34 PDB entries) Uniprot P20906 |
| Domain d1ynoa1: 1yno A:182-341 [123747] Other proteins in same PDB: d1ynoa2, d1ynoa3 automated match to d1q6za1 complexed with ca, mg, tzd |
PDB Entry: 1yno (more details), 1.22 Å
SCOPe Domain Sequences for d1ynoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ynoa1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap
Timeline for d1ynoa1: