Lineage for d1ynoa1 (1yno A:182-341)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828384Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 828385Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 828414Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 828438Protein Benzoylformate decarboxylase [52482] (1 species)
  7. 828439Species Pseudomonas putida [TaxId:303] [52483] (9 PDB entries)
    Uniprot P20906
  8. 828444Domain d1ynoa1: 1yno A:182-341 [123747]
    Other proteins in same PDB: d1ynoa2, d1ynoa3
    automatically matched to d1bfd_1
    complexed with ca, mg, tzd

Details for d1ynoa1

PDB Entry: 1yno (more details), 1.22 Å

PDB Description: High Resolution Structure of Benzoylformate Decarboxylase from Pseudomonas Putida Complexed with Thiamine Thiazolone Diphosphate
PDB Compounds: (A:) Benzoylformate decarboxylase

SCOP Domain Sequences for d1ynoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynoa1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

SCOP Domain Coordinates for d1ynoa1:

Click to download the PDB-style file with coordinates for d1ynoa1.
(The format of our PDB-style files is described here.)

Timeline for d1ynoa1: