![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
![]() | Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) ![]() automatically mapped to Pfam PF01000 |
![]() | Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins) |
![]() | Protein RNA polymerase alpha subunit [56555] (3 species) |
![]() | Species Thermus aquaticus [TaxId:271] [64461] (4 PDB entries) |
![]() | Domain d1ynjb2: 1ynj B:50-172 [123740] Other proteins in same PDB: d1ynja1, d1ynjb1, d1ynjc1, d1ynjd1, d1ynjk1 automatically matched to d1i6va2 protein/RNA complex; complexed with srn, zn |
PDB Entry: 1ynj (more details), 3.2 Å
SCOPe Domain Sequences for d1ynjb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ynjb2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus aquaticus [TaxId: 271]} gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkev ragdftpsadveimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvda ifs
Timeline for d1ynjb2: