Lineage for d1ynja1 (1ynj A:6-49,A:173-231)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1031575Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1031673Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 1031674Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 1031675Protein RNA polymerase alpha [55259] (3 species)
  7. 1031681Species Thermus aquaticus [TaxId:271] [64314] (4 PDB entries)
  8. 1031682Domain d1ynja1: 1ynj A:6-49,A:173-231 [123737]
    Other proteins in same PDB: d1ynja2, d1ynjb2, d1ynjc1, d1ynjd1, d1ynjk1
    automatically matched to d1i6vb1
    protein/RNA complex; complexed with srn, zn

Details for d1ynja1

PDB Entry: 1ynj (more details), 3.2 Å

PDB Description: Taq RNA polymerase-Sorangicin complex
PDB Compounds: (A:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d1ynja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynja1 d.74.3.1 (A:6-49,A:173-231) RNA polymerase alpha {Thermus aquaticus [TaxId: 271]}
lkapvftattqgdhygefvleplergfgvtlgnplrrillssipXpvrrvafqvedtrlg
qrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeas

SCOPe Domain Coordinates for d1ynja1:

Click to download the PDB-style file with coordinates for d1ynja1.
(The format of our PDB-style files is described here.)

Timeline for d1ynja1: