Lineage for d1ynic_ (1yni C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2580827Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2580828Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2580958Family d.126.1.7: Succinylarginine dihydrolase-like [143809] (2 proteins)
    Pfam PF04996
  6. 2580963Protein automated matches [190835] (1 species)
    not a true protein
  7. 2580964Species Escherichia coli [TaxId:562] [188143] (3 PDB entries)
  8. 2580975Domain d1ynic_: 1yni C: [123735]
    Other proteins in same PDB: d1ynia1
    automated match to d1ynfa1
    complexed with k, sug

Details for d1ynic_

PDB Entry: 1yni (more details), 2.2 Å

PDB Description: crystal structure of n-succinylarginine dihydrolase, astb, bound to substrate and product, an enzyme from the arginine catabolic pathway of escherichia coli
PDB Compounds: (C:) Succinylarginine Dihydrolase

SCOPe Domain Sequences for d1ynic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynic_ d.126.1.7 (C:) automated matches {Escherichia coli [TaxId: 562]}
nawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqav
ippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtl
dgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnr
lgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdv
idqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvs
tylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmangg
gpaslrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregr
ealdvlsqllnlgsvypfqr

SCOPe Domain Coordinates for d1ynic_:

Click to download the PDB-style file with coordinates for d1ynic_.
(The format of our PDB-style files is described here.)

Timeline for d1ynic_: