Lineage for d1ynib_ (1yni B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1039825Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 1039826Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 1039926Family d.126.1.7: Succinylarginine dihydrolase-like [143809] (2 proteins)
    Pfam PF04996
  6. 1039931Protein automated matches [190835] (1 species)
    not a true protein
  7. 1039932Species Escherichia coli [TaxId:562] [188143] (3 PDB entries)
  8. 1039942Domain d1ynib_: 1yni B: [123734]
    Other proteins in same PDB: d1ynia1
    automated match to d1ynfa1
    complexed with k, sug

Details for d1ynib_

PDB Entry: 1yni (more details), 2.2 Å

PDB Description: crystal structure of n-succinylarginine dihydrolase, astb, bound to substrate and product, an enzyme from the arginine catabolic pathway of escherichia coli
PDB Compounds: (B:) Succinylarginine Dihydrolase

SCOPe Domain Sequences for d1ynib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynib_ d.126.1.7 (B:) automated matches {Escherichia coli [TaxId: 562]}
nawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqav
ippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtl
dgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnr
lgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdv
idqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvs
tylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmangg
gpaslrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregr
ealdvlsqllnlgsvypfqr

SCOPe Domain Coordinates for d1ynib_:

Click to download the PDB-style file with coordinates for d1ynib_.
(The format of our PDB-style files is described here.)

Timeline for d1ynib_: