Lineage for d1ynhd_ (1ynh D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213803Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2213804Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2213928Family d.126.1.7: Succinylarginine dihydrolase-like [143809] (2 proteins)
    Pfam PF04996
  6. 2213933Protein automated matches [190835] (1 species)
    not a true protein
  7. 2213934Species Escherichia coli [TaxId:562] [188143] (3 PDB entries)
  8. 2213938Domain d1ynhd_: 1ynh D: [123732]
    automated match to d1ynfa1
    complexed with k, suo

Details for d1ynhd_

PDB Entry: 1ynh (more details), 1.95 Å

PDB Description: Crystal Structure of N-Succinylarginine Dihydrolase, AstB, bound to Substrate and Product, an Enzyme from the Arginine Catabolic Pathway of Escherichia coli
PDB Compounds: (D:) Succinylarginine Dihydrolase

SCOPe Domain Sequences for d1ynhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynhd_ d.126.1.7 (D:) automated matches {Escherichia coli [TaxId: 562]}
awevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqavi
ppherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtld
gkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnrl
gghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdvi
dqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvst
ylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmanggg
paclrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregre
aldvlsqllnlgsvypfqr

SCOPe Domain Coordinates for d1ynhd_:

Click to download the PDB-style file with coordinates for d1ynhd_.
(The format of our PDB-style files is described here.)

Timeline for d1ynhd_: