Lineage for d1ynhd1 (1ynh D:3-441)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872041Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 872042Superfamily d.126.1: Pentein [55909] (7 families) (S)
  5. 872145Family d.126.1.7: Succinylarginine dihydrolase-like [143809] (1 protein)
    Pfam PF04996
  6. 872146Protein Succinylarginine dihydrolase [143810] (1 species)
  7. 872147Species Escherichia coli [TaxId:562] [143811] (3 PDB entries)
    Uniprot P76216 2-441
  8. 872151Domain d1ynhd1: 1ynh D:3-441 [123732]
    automatically matched to 1YNF A:2-441
    complexed with k, suo

Details for d1ynhd1

PDB Entry: 1ynh (more details), 1.95 Å

PDB Description: Crystal Structure of N-Succinylarginine Dihydrolase, AstB, bound to Substrate and Product, an Enzyme from the Arginine Catabolic Pathway of Escherichia coli
PDB Compounds: (D:) Succinylarginine Dihydrolase

SCOP Domain Sequences for d1ynhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynhd1 d.126.1.7 (D:3-441) Succinylarginine dihydrolase {Escherichia coli [TaxId: 562]}
awevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqavi
ppherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtld
gkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnrl
gghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdvi
dqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvst
ylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmanggg
paclrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregre
aldvlsqllnlgsvypfqr

SCOP Domain Coordinates for d1ynhd1:

Click to download the PDB-style file with coordinates for d1ynhd1.
(The format of our PDB-style files is described here.)

Timeline for d1ynhd1: