![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis |
![]() | Superfamily d.126.1: Pentein [55909] (8 families) ![]() |
![]() | Family d.126.1.7: Succinylarginine dihydrolase-like [143809] (2 proteins) Pfam PF04996 |
![]() | Protein automated matches [190835] (1 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [188143] (3 PDB entries) |
![]() | Domain d1ynhb_: 1ynh B: [123730] automated match to d1ynfa1 complexed with k, suo |
PDB Entry: 1ynh (more details), 1.95 Å
SCOPe Domain Sequences for d1ynhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ynhb_ d.126.1.7 (B:) automated matches {Escherichia coli [TaxId: 562]} nawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqav ippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtl dgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnr lgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdv idqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvs tylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmangg gpaclrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregr ealdvlsqllnlgsvypfqr
Timeline for d1ynhb_: