Lineage for d1ynff_ (1ynf F:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1925324Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 1925325Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 1925433Family d.126.1.7: Succinylarginine dihydrolase-like [143809] (2 proteins)
    Pfam PF04996
  6. 1925438Protein automated matches [190835] (1 species)
    not a true protein
  7. 1925439Species Escherichia coli [TaxId:562] [188143] (3 PDB entries)
  8. 1925448Domain d1ynff_: 1ynf F: [123728]
    Other proteins in same PDB: d1ynfa1
    automated match to d1ynfa1
    complexed with k

Details for d1ynff_

PDB Entry: 1ynf (more details), 1.9 Å

PDB Description: Crystal Structure of N-Succinylarginine Dihydrolase, AstB, bound to Substrate and Product, an Enzyme from the Arginine Catabolic Pathway of Escherichia coli
PDB Compounds: (F:) Succinylarginine Dihydrolase

SCOPe Domain Sequences for d1ynff_:

Sequence, based on SEQRES records: (download)

>d1ynff_ d.126.1.7 (F:) automated matches {Escherichia coli [TaxId: 562]}
nawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqav
ippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtl
dgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnr
lgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdv
idqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvs
tylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmangg
gpaclrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregr
ealdvlsqllnlgsvypfqr

Sequence, based on observed residues (ATOM records): (download)

>d1ynff_ d.126.1.7 (F:) automated matches {Escherichia coli [TaxId: 562]}
nawevnfdglvglthhyahrfqvsnprlaakqgllkmkaladagfpqavippherpfipv
lrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtldgkvhltvanl
nnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnrlgghygepgmq
lfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdvidqgvfhndvi
avsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvstylfnsqllsr
ddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmangggpaclrlrvvl
teeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregrealdvlsqlln
lgsvypfqr

SCOPe Domain Coordinates for d1ynff_:

Click to download the PDB-style file with coordinates for d1ynff_.
(The format of our PDB-style files is described here.)

Timeline for d1ynff_: