Lineage for d1ynfe1 (1ynf E:2-441)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732825Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 732826Superfamily d.126.1: Pentein [55909] (7 families) (S)
  5. 732922Family d.126.1.7: Succinylarginine dihydrolase-like [143809] (1 protein)
    Pfam PF04996
  6. 732923Protein Succinylarginine dihydrolase [143810] (1 species)
  7. 732924Species Escherichia coli [TaxId:562] [143811] (3 PDB entries)
  8. 732929Domain d1ynfe1: 1ynf E:2-441 [123727]
    automatically matched to 1YNF A:2-441
    complexed with k

Details for d1ynfe1

PDB Entry: 1ynf (more details), 1.9 Å

PDB Description: Crystal Structure of N-Succinylarginine Dihydrolase, AstB, bound to Substrate and Product, an Enzyme from the Arginine Catabolic Pathway of Escherichia coli
PDB Compounds: (E:) Succinylarginine Dihydrolase

SCOP Domain Sequences for d1ynfe1:

Sequence, based on SEQRES records: (download)

>d1ynfe1 d.126.1.7 (E:2-441) Succinylarginine dihydrolase {Escherichia coli [TaxId: 562]}
nawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqav
ippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtl
dgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnr
lgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdv
idqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvs
tylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmangg
gpaclrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregr
ealdvlsqllnlgsvypfqr

Sequence, based on observed residues (ATOM records): (download)

>d1ynfe1 d.126.1.7 (E:2-441) Succinylarginine dihydrolase {Escherichia coli [TaxId: 562]}
nawevnfdglvglthhyahrfqvsnprlaakqgllkmkaladagfpqavippherpfipv
lrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtldgkvhltvanl
nnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnrlgghygepgmq
lfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdvidqgvfhndvi
avsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvstylfnsqllsr
ddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmangggpaclrlrvvl
teeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregrealdvlsqlln
lgsvypfqr

SCOP Domain Coordinates for d1ynfe1:

Click to download the PDB-style file with coordinates for d1ynfe1.
(The format of our PDB-style files is described here.)

Timeline for d1ynfe1: