Lineage for d1ynfc_ (1ynf C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537906Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2537907Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2538031Family d.126.1.7: Succinylarginine dihydrolase-like [143809] (2 proteins)
    Pfam PF04996
  6. 2538036Protein automated matches [190835] (1 species)
    not a true protein
  7. 2538037Species Escherichia coli [TaxId:562] [188143] (3 PDB entries)
  8. 2538043Domain d1ynfc_: 1ynf C: [123725]
    Other proteins in same PDB: d1ynfa1
    automated match to d1ynfa1
    complexed with k

Details for d1ynfc_

PDB Entry: 1ynf (more details), 1.9 Å

PDB Description: Crystal Structure of N-Succinylarginine Dihydrolase, AstB, bound to Substrate and Product, an Enzyme from the Arginine Catabolic Pathway of Escherichia coli
PDB Compounds: (C:) Succinylarginine Dihydrolase

SCOPe Domain Sequences for d1ynfc_:

Sequence, based on SEQRES records: (download)

>d1ynfc_ d.126.1.7 (C:) automated matches {Escherichia coli [TaxId: 562]}
nawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqav
ippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtl
dgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnr
lgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdv
idqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvs
tylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmangg
gpaclrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregr
ealdvlsqllnlgsvypfqr

Sequence, based on observed residues (ATOM records): (download)

>d1ynfc_ d.126.1.7 (C:) automated matches {Escherichia coli [TaxId: 562]}
nawevnfdglvglthhyahrfqvsnprlaakqgllkmkaladagfpqavippherpfipv
lrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtldgkvhltvanl
nnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnrlgghygepgmq
lfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdvidqgvfhndvi
avsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvstylfnsqllsr
ddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmangggpaclrlrvvl
teeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregrealdvlsqlln
lgsvypfqr

SCOPe Domain Coordinates for d1ynfc_:

Click to download the PDB-style file with coordinates for d1ynfc_.
(The format of our PDB-style files is described here.)

Timeline for d1ynfc_: