Lineage for d1ynfb_ (1ynf B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. Family d.126.1.7: Succinylarginine dihydrolase-like [143809] (2 proteins)
    Pfam PF04996
  6. Protein automated matches [190835] (1 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [188143] (3 PDB entries)
  8. Domain d1ynfb_: 1ynf B: [123724]
    Other proteins in same PDB: d1ynfa1
    automated match to d1ynfa1
    complexed with k

Details for d1ynfb_

PDB Entry: 1ynf (more details), 1.9 Å

PDB Description: Crystal Structure of N-Succinylarginine Dihydrolase, AstB, bound to Substrate and Product, an Enzyme from the Arginine Catabolic Pathway of Escherichia coli
PDB Compounds: (B:) Succinylarginine Dihydrolase

SCOPe Domain Sequences for d1ynfb_:

Sequence, based on SEQRES records: (download)

>d1ynfb_ d.126.1.7 (B:) automated matches {Escherichia coli [TaxId: 562]}
nawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqav
ippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtl
dgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnr
lgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdv
idqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvs
tylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmangg
gpaclrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregr
ealdvlsqllnlgsvypfqr

Sequence, based on observed residues (ATOM records): (download)

>d1ynfb_ d.126.1.7 (B:) automated matches {Escherichia coli [TaxId: 562]}
nawevnfdglvglthhyahrfqvsnprlaakqgllkmkaladagfpqavippherpfipv
lrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtldgkvhltvanl
nnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnrlgghygepgmq
lfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdvidqgvfhndvi
avsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvstylfnsqllsr
ddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmangggpaclrlrvvl
teeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregrealdvlsqlln
lgsvypfqr

SCOPe Domain Coordinates for d1ynfb_ are not available.

Timeline for d1ynfb_:

Domains from other chains:
(mouse over for more information)
d1ynfa1, d1ynfc_, d1ynfd_, d1ynfe_, d1ynff_