Lineage for d1ynfa1 (1ynf A:2-441)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1925324Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 1925325Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 1925433Family d.126.1.7: Succinylarginine dihydrolase-like [143809] (2 proteins)
    Pfam PF04996
  6. 1925434Protein Succinylarginine dihydrolase [143810] (1 species)
  7. 1925435Species Escherichia coli [TaxId:562] [143811] (2 PDB entries)
    Uniprot P76216 2-441
  8. 1925436Domain d1ynfa1: 1ynf A:2-441 [123723]
    Other proteins in same PDB: d1ynfb_, d1ynfc_, d1ynfd_, d1ynfe_, d1ynff_
    complexed with k

Details for d1ynfa1

PDB Entry: 1ynf (more details), 1.9 Å

PDB Description: Crystal Structure of N-Succinylarginine Dihydrolase, AstB, bound to Substrate and Product, an Enzyme from the Arginine Catabolic Pathway of Escherichia coli
PDB Compounds: (A:) Succinylarginine Dihydrolase

SCOPe Domain Sequences for d1ynfa1:

Sequence, based on SEQRES records: (download)

>d1ynfa1 d.126.1.7 (A:2-441) Succinylarginine dihydrolase {Escherichia coli [TaxId: 562]}
nawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqav
ippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtl
dgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnr
lgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdv
idqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvs
tylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmangg
gpaclrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregr
ealdvlsqllnlgsvypfqr

Sequence, based on observed residues (ATOM records): (download)

>d1ynfa1 d.126.1.7 (A:2-441) Succinylarginine dihydrolase {Escherichia coli [TaxId: 562]}
nawevnfdglvglthhyahrfqvsnprlaakqgllkmkaladagfpqavippherpfipv
lrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtldgkvhltvanl
nnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnrlgghygepgmq
lfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdvidqgvfhndvi
avsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvstylfnsqllsr
ddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmangggpaclrlrvvl
teeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregrealdvlsqlln
lgsvypfqr

SCOPe Domain Coordinates for d1ynfa1:

Click to download the PDB-style file with coordinates for d1ynfa1.
(The format of our PDB-style files is described here.)

Timeline for d1ynfa1: