Lineage for d1ynbc1 (1ynb C:7-173)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651135Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 651136Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) (S)
  5. 651137Family a.211.1.1: HD domain [101340] (6 proteins)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 651142Protein Hypothetical protein AF1432 [140763] (1 species)
  7. 651143Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [140764] (2 PDB entries)
  8. 651146Domain d1ynbc1: 1ynb C:7-173 [123720]
    automatically matched to 1YNB A:7-173

Details for d1ynbc1

PDB Entry: 1ynb (more details), 1.76 Å

PDB Description: crystal structure of genomics APC5600
PDB Compounds: (C:) hypothetical protein AF1432

SCOP Domain Sequences for d1ynbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynbc1 a.211.1.1 (C:7-173) Hypothetical protein AF1432 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
mddvvkfihevgslkltprsgwlklgirlpesvaehnfraaiiafilalksgesvekack
aataalfhdlheartmdlhkiarryvscdeegareeqlswmeskpdfsdvevyvsdadkl
elafqgveysqqvsyairfaenvelktdaakeiyrvlmerknpvwwr

SCOP Domain Coordinates for d1ynbc1:

Click to download the PDB-style file with coordinates for d1ynbc1.
(The format of our PDB-style files is described here.)

Timeline for d1ynbc1: