Lineage for d1ynba1 (1ynb A:7-173)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014837Family a.211.1.1: HD domain [101340] (14 protein domains)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 2014846Protein Hypothetical protein AF1432 [140763] (1 species)
  7. 2014847Species Archaeoglobus fulgidus [TaxId:2234] [140764] (2 PDB entries)
    Uniprot O28840 7-172! Uniprot O28840 7-173
  8. 2014848Domain d1ynba1: 1ynb A:7-173 [123718]

Details for d1ynba1

PDB Entry: 1ynb (more details), 1.76 Å

PDB Description: crystal structure of genomics APC5600
PDB Compounds: (A:) hypothetical protein AF1432

SCOPe Domain Sequences for d1ynba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynba1 a.211.1.1 (A:7-173) Hypothetical protein AF1432 {Archaeoglobus fulgidus [TaxId: 2234]}
mddvvkfihevgslkltprsgwlklgirlpesvaehnfraaiiafilalksgesvekack
aataalfhdlheartmdlhkiarryvscdeegareeqlswmeskpdfsdvevyvsdadkl
elafqgveysqqvsyairfaenvelktdaakeiyrvlmerknpvwwr

SCOPe Domain Coordinates for d1ynba1:

Click to download the PDB-style file with coordinates for d1ynba1.
(The format of our PDB-style files is described here.)

Timeline for d1ynba1: