Lineage for d1yn7a2 (1yn7 A:3-180)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938064Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries)
  8. 2938071Domain d1yn7a2: 1yn7 A:3-180 [123716]
    Other proteins in same PDB: d1yn7a1, d1yn7b2, d1yn7b3
    automatically matched to d1ddha2

Details for d1yn7a2

PDB Entry: 1yn7 (more details), 2.2 Å

PDB Description: crystal structure of a mouse mhc class i protein, h2-db, in complex with a mutated peptide (r7a) of the influenza a acid polymerase
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1yn7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yn7a2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

SCOPe Domain Coordinates for d1yn7a2:

Click to download the PDB-style file with coordinates for d1yn7a2.
(The format of our PDB-style files is described here.)

Timeline for d1yn7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yn7a1