Lineage for d1yn6b2 (1yn6 B:1-99)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2746421Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 2746483Domain d1yn6b2: 1yn6 B:1-99 [123714]
    Other proteins in same PDB: d1yn6a1, d1yn6a2, d1yn6b3
    automated match to d1bz9b_

Details for d1yn6b2

PDB Entry: 1yn6 (more details), 2.2 Å

PDB Description: Crystal structure of a mouse MHC class I protein, H2-Db, in complex with a peptide from the influenza A acid polymerase
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1yn6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yn6b2 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1yn6b2:

Click to download the PDB-style file with coordinates for d1yn6b2.
(The format of our PDB-style files is described here.)

Timeline for d1yn6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yn6b3