Lineage for d1yn6a2 (1yn6 A:3-180)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198308Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (21 PDB entries)
  8. 1198321Domain d1yn6a2: 1yn6 A:3-180 [123713]
    Other proteins in same PDB: d1yn6a1, d1yn6b_
    automatically matched to d1ddha2

Details for d1yn6a2

PDB Entry: 1yn6 (more details), 2.2 Å

PDB Description: Crystal structure of a mouse MHC class I protein, H2-Db, in complex with a peptide from the influenza A acid polymerase
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1yn6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yn6a2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

SCOPe Domain Coordinates for d1yn6a2:

Click to download the PDB-style file with coordinates for d1yn6a2.
(The format of our PDB-style files is described here.)

Timeline for d1yn6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yn6a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1yn6b_