Lineage for d1ymyb1 (1ymy B:1-53,B:351-382)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678879Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 678880Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (8 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 678998Family b.92.1.5: N-acetylglucosamine-6-phosphate deacetylase, NagA [82227] (1 protein)
  6. 678999Protein N-acetylglucosamine-6-phosphate deacetylase, NagA [82228] (3 species)
  7. 679003Species Escherichia coli [TaxId:562] [141688] (2 PDB entries)
  8. 679007Domain d1ymyb1: 1ymy B:1-53,B:351-382 [123710]
    Other proteins in same PDB: d1ymya2, d1ymyb2
    automatically matched to 1YMY A:1-53,A:351-382

Details for d1ymyb1

PDB Entry: 1ymy (more details), 2.6 Å

PDB Description: crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12
PDB Compounds: (B:) N-acetylglucosamine-6-phosphate deacetylase

SCOP Domain Sequences for d1ymyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ymyb1 b.92.1.5 (B:1-53,B:351-382) N-acetylglucosamine-6-phosphate deacetylase, NagA {Escherichia coli [TaxId: 562]}
myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspXtlaagk
vanltaftpdfkitktivngnevvtq

SCOP Domain Coordinates for d1ymyb1:

Click to download the PDB-style file with coordinates for d1ymyb1.
(The format of our PDB-style files is described here.)

Timeline for d1ymyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ymyb2