SCOPe 2.08: Domain d1ymyb1: 1ymy B:1-53,B:351-382

Lineage for d1ymyb1 (1ymy B:1-53,B:351-382)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.5: N-acetylglucosamine-6-phosphate deacetylase, NagA [82227] (1 protein)

6. Protein N-acetylglucosamine-6-phosphate deacetylase, NagA [82228] (3 species)

7. Species Escherichia coli [TaxId:562] [141688] (4 PDB entries)
   Uniprot P0AF18 1-53,351-382

8. Domain d1ymyb1: 1ymy B:1-53,B:351-382 [123710]
   Other proteins in same PDB: d1ymya2, d1ymyb2
   automated match to d1ymya1

Details for d1ymyb1

PDB Entry: 1ymy, 2.6 Å

PDB Description: crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12

PDB Compounds: (B:) N-acetylglucosamine-6-phosphate deacetylase

SCOPe Domain Sequences for d1ymyb1:

Sequence; same for both SEQRES and ATOM records:

>d1ymyb1 b.92.1.5 (B:1-53,B:351-382) N-acetylglucosamine-6-phosphate deacetylase, NagA {Escherichia coli [TaxId: 562]}
myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspXtlaagk
vanltaftpdfkitktivngnevvtq

Timeline for d1ymyb1:

• d1ymyb1 first appeared in SCOP 1.73
  
• d1ymyb1 appears in SCOPe 2.07