Lineage for d1ymme2 (1ymm E:123-246)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786831Protein T-cell antigen receptor [49125] (6 species)
  7. 786857Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries)
  8. 786894Domain d1ymme2: 1ymm E:123-246 [123706]
    Other proteins in same PDB: d1ymma1, d1ymma2, d1ymmb1, d1ymmb2, d1ymmd1, d1ymme1
    automatically matched to d1ogae2
    complexed with nag; mutant

Details for d1ymme2

PDB Entry: 1ymm (more details), 3.5 Å

PDB Description: tcr/hla-dr2b/mbp-peptide complex
PDB Compounds: (E:) T-cell receptor beta chain

SCOP Domain Sequences for d1ymme2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ymme2 b.1.1.2 (E:123-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk
eqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
awgr

SCOP Domain Coordinates for d1ymme2:

Click to download the PDB-style file with coordinates for d1ymme2.
(The format of our PDB-style files is described here.)

Timeline for d1ymme2: