Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries) Uniprot P04229 30-219 |
Domain d1ymmb2: 1ymm B:3-92 [123704] Other proteins in same PDB: d1ymma1, d1ymma2, d1ymmb1, d1ymmd1, d1ymme1, d1ymme2 automatically matched to d1bx2b2 complexed with nag |
PDB Entry: 1ymm (more details), 3.5 Å
SCOPe Domain Sequences for d1ymmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ymmb2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]} trprflwqpkrechffngtervrfldryfynqeesvrfdsdvgefravtelgrpdaeywn sqkdileqaraavdtycrhnygvvesftvq
Timeline for d1ymmb2: