Lineage for d1ymmb2 (1ymm B:3-92)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2183369Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2183411Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries)
    Uniprot P04229 30-219
  8. 2183430Domain d1ymmb2: 1ymm B:3-92 [123704]
    Other proteins in same PDB: d1ymma1, d1ymma2, d1ymmb1, d1ymmd1, d1ymme1, d1ymme2
    automatically matched to d1bx2b2
    complexed with nag

Details for d1ymmb2

PDB Entry: 1ymm (more details), 3.5 Å

PDB Description: tcr/hla-dr2b/mbp-peptide complex
PDB Compounds: (B:) HLA class II histocompatibility antigen, DR beta chain

SCOPe Domain Sequences for d1ymmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ymmb2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
trprflwqpkrechffngtervrfldryfynqeesvrfdsdvgefravtelgrpdaeywn
sqkdileqaraavdtycrhnygvvesftvq

SCOPe Domain Coordinates for d1ymmb2:

Click to download the PDB-style file with coordinates for d1ymmb2.
(The format of our PDB-style files is described here.)

Timeline for d1ymmb2: