Lineage for d1ymma1 (1ymm A:83-179)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654849Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 654899Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (20 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 654934Domain d1ymma1: 1ymm A:83-179 [123701]
    Other proteins in same PDB: d1ymma2, d1ymmb1, d1ymmb2, d1ymme1, d1ymme2
    automatically matched to d1k2da1
    complexed with nag; mutant

Details for d1ymma1

PDB Entry: 1ymm (more details), 3.5 Å

PDB Description: TCR/HLA-DR2b/MBP-peptide complex
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOP Domain Sequences for d1ymma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ymma1 b.1.1.2 (A:83-179) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpred
hlfrkfhylpflpstedvydcrvehwgldepllkhwe

SCOP Domain Coordinates for d1ymma1:

Click to download the PDB-style file with coordinates for d1ymma1.
(The format of our PDB-style files is described here.)

Timeline for d1ymma1: