Lineage for d1ymka1 (1ymk A:377-550)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698897Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 698898Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (4 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 698899Family c.46.1.1: Cell cycle control phosphatase, catalytic domain [52822] (4 proteins)
  6. 698903Protein CDC25b [52825] (1 species)
  7. 698904Species Human (Homo sapiens) [TaxId:9606] [52826] (9 PDB entries)
  8. 698905Domain d1ymka1: 1ymk A:377-550 [123699]
    automatically matched to d1cwsa_
    complexed with cl

Details for d1ymka1

PDB Entry: 1ymk (more details), 1.7 Å

PDB Description: crystal structure of the cdc25b phosphatase catalytic domain in the apo form
PDB Compounds: (A:) M-phase inducer phosphatase 2

SCOP Domain Sequences for d1ymka1:

Sequence, based on SEQRES records: (download)

>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]}
eligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyeggh
iktavnlplerdaesfllkspiapcsldkrvilifhcefssergprmcrfirerdravnd
ypslyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrsw

Sequence, based on observed residues (ATOM records): (download)

>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]}
eligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyeggh
iktavnlplerdaesfllkspiapkrvilifhcefssergprmcrfirerdravndypsl
yypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrsw

SCOP Domain Coordinates for d1ymka1:

Click to download the PDB-style file with coordinates for d1ymka1.
(The format of our PDB-style files is described here.)

Timeline for d1ymka1: