Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein G-protein coupled receptor kinase 2 [90034] (1 species) AGC group; GRKs subfamily; serine/threonine kinase |
Species Cow (Bos taurus) [TaxId:9913] [90035] (6 PDB entries) |
Domain d1ym7d3: 1ym7 D:186-542 [123696] Other proteins in same PDB: d1ym7a1, d1ym7a2, d1ym7b1, d1ym7b2, d1ym7c1, d1ym7c2, d1ym7d1, d1ym7d2 automatically matched to d1omwa3 |
PDB Entry: 1ym7 (more details), 4.5 Å
SCOPe Domain Sequences for d1ym7d3:
Sequence, based on SEQRES records: (download)
>d1ym7d3 d.144.1.7 (D:186-542) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaadafdi gsfdeedtkgiklldsdqelyrnfpltiserwqqevaetvfdtinaetdrlearkkt
>d1ym7d3 d.144.1.7 (D:186-542) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgtkgiklldsd qelyrnfpltiserwqqevaetvfdtinaetdrlearkkt
Timeline for d1ym7d3: