| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) ![]() |
| Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins) |
| Protein G-protein coupled receptor kinase 2, N-terminal domain [89090] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [89091] (6 PDB entries) |
| Domain d1ym7c1: 1ym7 C:29-185 [123691] Other proteins in same PDB: d1ym7a2, d1ym7a3, d1ym7b2, d1ym7b3, d1ym7c2, d1ym7c3, d1ym7d2, d1ym7d3 automatically matched to d1omwa1 |
PDB Entry: 1ym7 (more details), 4.5 Å
SCOPe Domain Sequences for d1ym7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ym7c1 a.91.1.1 (C:29-185) G-protein coupled receptor kinase 2, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
skkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclkhleeakplvefyee
ikkyekleteeerlvcsreifdtyimkellacshpfsksaiehvqghlvkkqvppdlfqp
yieeicqnlrgdvfqkfiesdkftrfcqwknvelnih
Timeline for d1ym7c1: