Lineage for d1ym7c1 (1ym7 C:29-185)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719790Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2719791Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2719792Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 2719797Protein G-protein coupled receptor kinase 2, N-terminal domain [89090] (1 species)
  7. 2719798Species Cow (Bos taurus) [TaxId:9913] [89091] (6 PDB entries)
  8. 2719806Domain d1ym7c1: 1ym7 C:29-185 [123691]
    Other proteins in same PDB: d1ym7a2, d1ym7a3, d1ym7b2, d1ym7b3, d1ym7c2, d1ym7c3, d1ym7d2, d1ym7d3
    automatically matched to d1omwa1

Details for d1ym7c1

PDB Entry: 1ym7 (more details), 4.5 Å

PDB Description: g protein-coupled receptor kinase 2 (grk2)
PDB Compounds: (C:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d1ym7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ym7c1 a.91.1.1 (C:29-185) G-protein coupled receptor kinase 2, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
skkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclkhleeakplvefyee
ikkyekleteeerlvcsreifdtyimkellacshpfsksaiehvqghlvkkqvppdlfqp
yieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

SCOPe Domain Coordinates for d1ym7c1:

Click to download the PDB-style file with coordinates for d1ym7c1.
(The format of our PDB-style files is described here.)

Timeline for d1ym7c1: