Lineage for d1ym7b2 (1ym7 B:550-656)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2061578Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 protein domains)
    Pfam PF00169
  6. 2061658Protein G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) [50747] (2 species)
  7. 2061659Species Cow (Bos taurus) [TaxId:9913] [89354] (6 PDB entries)
  8. 2061666Domain d1ym7b2: 1ym7 B:550-656 [123689]
    Other proteins in same PDB: d1ym7a1, d1ym7a3, d1ym7b1, d1ym7b3, d1ym7c1, d1ym7c3, d1ym7d1, d1ym7d3
    automatically matched to d1omwa2

Details for d1ym7b2

PDB Entry: 1ym7 (more details), 4.5 Å

PDB Description: G Protein-Coupled Receptor Kinase 2 (GRK2)
PDB Compounds: (B:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d1ym7b2:

Sequence, based on SEQRES records: (download)

>d1ym7b2 b.55.1.1 (B:550-656) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqq

Sequence, based on observed residues (ATOM records): (download)

>d1ym7b2 b.55.1.1 (B:550-656) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]}
eedyalgkdcimhgymskmgntqwqrryfylfpnrlewrgegeapqslltmeeiqsveet
qikerkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqq

SCOPe Domain Coordinates for d1ym7b2:

Click to download the PDB-style file with coordinates for d1ym7b2.
(The format of our PDB-style files is described here.)

Timeline for d1ym7b2: