Lineage for d1ym2c1 (1ym2 C:-2-385)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 803906Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 803907Superfamily b.50.1: Acid proteases [50630] (3 families) (S)
  5. 804499Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 804554Protein beta-secretase (memapsin) [50671] (1 species)
  7. 804555Species Human (Homo sapiens) [TaxId:9606] [50672] (51 PDB entries)
    Uniprot P56817 58-446
    Uniprot P56817 60-447
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 804595Domain d1ym2c1: 1ym2 C:-2-385 [123681]
    automatically matched to d1fkna_
    complexed with aua

Details for d1ym2c1

PDB Entry: 1ym2 (more details), 2.05 Å

PDB Description: Crystal structure of human beta secretase complexed with NVP-AUR200
PDB Compounds: (C:) Beta-secretase 1

SCOP Domain Sequences for d1ym2c1:

Sequence, based on SEQRES records: (download)

>d1ym2c1 b.50.1.2 (C:-2-385) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
sfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqls
styrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnweg
ilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmiig
gidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlp
kkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfr
itilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavs
achvhdefrtaavegpfvtldmedcgyn

Sequence, based on observed residues (ATOM records): (download)

>d1ym2c1 b.50.1.2 (C:-2-385) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
sfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqls
styrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnweg
ilglayaeiarpddslepffdslvkqthvpnlfslqlcgavggsmiiggidhslytgslw
ytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavksik
aasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqylrpv
edvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaa
vegpfvtldmedcgyn

SCOP Domain Coordinates for d1ym2c1:

Click to download the PDB-style file with coordinates for d1ym2c1.
(The format of our PDB-style files is described here.)

Timeline for d1ym2c1: