SCOPe 2.07: Domain d1ylxb_: 1ylx B:

Lineage for d1ylxb_ (1ylx B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
   alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet

4. Superfamily d.82.5: GK1464-like [143579] (1 family)
   dimer; pseudo barrel; the true dimeric barrel formation requires swapping of the C-ternimal beta-alpha units

5. Family d.82.5.1: GK1464-like [143580] (2 proteins)

6. Protein automated matches [190832] (1 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [188138] (1 PDB entry)

8. Domain d1ylxb_: 1ylx B: [123678]
   Other proteins in same PDB: d1ylxa1
   automated match to d1ylxa1

Details for d1ylxb_

PDB Entry: 1ylx, 1.6 Å

PDB Description: Crystal Structure of a Protein of Unknown Function from Bacillus stearothermophilus

PDB Compounds: (B:) hypothetical protein APC35702

SCOPe Domain Sequences for d1ylxb_:

Sequence; same for both SEQRES and ATOM records:

>d1ylxb_ d.82.5.1 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mefaprsvvieefidtlepmmeaygldqvgifeehgegnryyvgytinkddemitihmpf
vknergelalekqewtvrkdgrekkgfhslqeameevihs

Timeline for d1ylxb_:

• d1ylxb_ first appeared in SCOP 1.73, called d1ylxb1
  
• d1ylxb_ appears in SCOPe 2.06
  
• d1ylxb_ appears in the current release, SCOPe 2.08