| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
Superfamily d.82.5: GK1464-like [143579] (1 family) ![]() dimer; pseudo barrel; the true dimeric barrel formation requires swapping of the C-ternimal beta-alpha units |
| Family d.82.5.1: GK1464-like [143580] (2 proteins) |
| Protein automated matches [190832] (1 species) not a true protein |
| Species Geobacillus stearothermophilus [TaxId:1422] [188138] (1 PDB entry) |
| Domain d1ylxb_: 1ylx B: [123678] Other proteins in same PDB: d1ylxa1 automated match to d1ylxa1 |
PDB Entry: 1ylx (more details), 1.6 Å
SCOPe Domain Sequences for d1ylxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ylxb_ d.82.5.1 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mefaprsvvieefidtlepmmeaygldqvgifeehgegnryyvgytinkddemitihmpf
vknergelalekqewtvrkdgrekkgfhslqeameevihs
Timeline for d1ylxb_: