SCOPe 2.01: Domain d1ylub_: 1ylu B:

Lineage for d1ylub_ (1ylu B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families)

5. Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)

6. Protein automated matches [190153] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186877] (3 PDB entries)

8. Domain d1ylub_: 1ylu B: [123676]
   automated match to d1ds7a_
   complexed with act, fmn

Details for d1ylub_

PDB Entry: 1ylu, 2 Å

PDB Description: The structure of E. coli nitroreductase with bound acetate, crystal form 2

PDB Compounds: (B:) oxygen-insensitive nad(p)h nitroreductase

SCOPe Domain Sequences for d1ylub_:

Sequence; same for both SEQRES and ATOM records:

>d1ylub_ d.90.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
diisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarva
ksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkgr
kffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglkek
gytslvvvpvghhsvedfnatlpksrlpqnitltev

Timeline for d1ylub_:

• d1ylub_ first appeared in SCOP 1.73, called d1ylub1
  
• d1ylub_ was called d1ylub1 in SCOP 1.75
  
• d1ylub_ appears in SCOPe 2.02
  
• d1ylub_ appears in the current release, SCOPe 2.08