SCOP 1.73: Domain d1ylqb1: 1ylq B:1-90

Lineage for d1ylqb1 (1ylq B:1-90)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (11 families)

5. Family d.218.1.5: Catalytic subunit of bi-partite nucleotidyltransferase [102932] (3 proteins)
   insert X in the core is an alpha-helix; minimal nucleotidyltransferase fold

6. Protein Putative nucleotidyltransferase AF0614 [143232] (1 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [143233] (1 PDB entry)

8. Domain d1ylqb1: 1ylq B:1-90 [123672]
   automatically matched to 1YLQ A:1-90
   complexed with so4

Details for d1ylqb1

PDB Entry: 1ylq, 2.02 Å

PDB Description: Crystal structure of putative nucleotidyltransferase

PDB Compounds: (B:) putative nucleotidyltransferase, hypothetical protein AF0614

SCOP Domain Sequences for d1ylqb1:

Sequence; same for both SEQRES and ATOM records:

>d1ylqb1 d.218.1.5 (B:1-90) Putative nucleotidyltransferase AF0614 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
mkeikeitkkdvqdaeiylygsvvegdysiglsdidvaivsdvfedrnrkleffgkitkk
ffdspfefhiltkkewkmskrfirkyrrld

Timeline for d1ylqb1:

• d1ylqb1 is new in SCOP 1.73
  
• d1ylqb1 appears in SCOP 1.75
  
• d1ylqb1 appears in the current release, SCOPe 2.08, called d1ylqb2