| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) ![]() |
| Family d.218.1.5: Catalytic subunit of bi-partite nucleotidyltransferase [102932] (4 proteins) insert X in the core is an alpha-helix; minimal nucleotidyltransferase fold automatically mapped to Pfam PF01909 |
| Protein automated matches [190831] (1 species) not a true protein |
| Species Archaeoglobus fulgidus [TaxId:2234] [188137] (1 PDB entry) |
| Domain d1ylqb2: 1ylq B:1-90 [123672] Other proteins in same PDB: d1ylqa1, d1ylqa2, d1ylqb3 automated match to d1ylqa1 complexed with so4 |
PDB Entry: 1ylq (more details), 2.02 Å
SCOPe Domain Sequences for d1ylqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ylqb2 d.218.1.5 (B:1-90) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkeikeitkkdvqdaeiylygsvvegdysiglsdidvaivsdvfedrnrkleffgkitkk
ffdspfefhiltkkewkmskrfirkyrrld
Timeline for d1ylqb2: