Lineage for d1ylqa1 (1ylq A:1-90)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612756Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2612757Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2613105Family d.218.1.5: Catalytic subunit of bi-partite nucleotidyltransferase [102932] (4 proteins)
    insert X in the core is an alpha-helix; minimal nucleotidyltransferase fold
    automatically mapped to Pfam PF01909
  6. 2613110Protein Putative nucleotidyltransferase AF0614 [143232] (1 species)
  7. 2613111Species Archaeoglobus fulgidus [TaxId:2234] [143233] (1 PDB entry)
    Uniprot O29641 1-90
  8. 2613112Domain d1ylqa1: 1ylq A:1-90 [123671]
    Other proteins in same PDB: d1ylqa2, d1ylqb2, d1ylqb3
    complexed with so4

Details for d1ylqa1

PDB Entry: 1ylq (more details), 2.02 Å

PDB Description: Crystal structure of putative nucleotidyltransferase
PDB Compounds: (A:) putative nucleotidyltransferase, hypothetical protein AF0614

SCOPe Domain Sequences for d1ylqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylqa1 d.218.1.5 (A:1-90) Putative nucleotidyltransferase AF0614 {Archaeoglobus fulgidus [TaxId: 2234]}
mkeikeitkkdvqdaeiylygsvvegdysiglsdidvaivsdvfedrnrkleffgkitkk
ffdspfefhiltkkewkmskrfirkyrrld

SCOPe Domain Coordinates for d1ylqa1:

Click to download the PDB-style file with coordinates for d1ylqa1.
(The format of our PDB-style files is described here.)

Timeline for d1ylqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ylqa2